EMP1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant EMP1.
Immunogen
EMP1 (AAH47300, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag.
Sequence
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.38 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — EMP1
-
Interactome
-
Publication Reference
-
The expression and function of epithelial membrane protein 1 in laryngeal carcinoma.
Li H, Zhang X, Jiang X, Ji X.
International Journal of Oncology 2017 Jan; 50(1):141.
Application:IHC-P, Human, Human laryngeal carcinoma tissues.
-
Suppression of trophoblast cell surface antigen 2 enhances proliferation and migration in liver fluke-associated cholangiocarcinoma.
Sawanyawisuth K, Tantapotinan N, Wongkham C, Riggins GJ, Kraiklang R, Wongkham S, Puapairoj A.
Annals of hepatology 2016 Jan; 15(1):71.
Application:ICC, WB, Human, KKU-M213, KKU-M214 cells.
-
The somatostatin analogue octreotide inhibits growth of small intestine neuroendocrine tumour cells.
Li SC, Martijn C, Cui T, Essaghir A, Luque RM, Demoulin JB, Castaño JP, Öberg K, Giandomenico V.
PLoS One 2012 Oct; 7(10):e48411.
Application:WB-Ce, Human, CNDT2.5 cells.
-
Knockdown Epithelial Membrane Protein 1 Suppresses Human Degenerative Intervertebral Disc?VDerived Nucleus Pulposus Cell Proliferation.
L ZY, Xiong SH, Hu M, Zhang CS.
Cartilage 2011 Jul; 2(3):300.
Application:WB-Tr, Human, Nucleus pulposus cells.
-
Epithelial Membrane Protein 1 Inhibits Human Spinal Chondrocyte Differentiation.
Li ZY, Xiong SH, Hu M, Zhang CS.
The Anatomical Record 2011 Jun; 294(6):1015.
Application:WB, Human, Fetal nucleus pulposus cells.
-
The expression of EMP1 is downregulated in oral squamous cell carcinoma and possibly associated with tumour metastasis.
Zhang J, Cao W, Xu Q, Chen WT.
Journal of Clinical Pathology 2011 Jan; 64(1):25.
Application:IHC-P, Human, Human oral squamous cell carcinoma.
-
Up-regulation of epithelial membrane protein-1 in the temporal neocortex of patients with intractable epilepsy.
Li YQ, Xue T, Wang L, Xu ZC, Xi ZQ, Yuan J, Wang XF, Chen YM, Zhang M, Yao L.
Neurochemical Research 2009 Sep; 34(9):1594.
Application:IF, IHC-P, Human, Human temporal neocortex.
-
Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.
Turashvili G, Bouchal J, Baumforth K, Wei W, Dziechciarkova M, Ehrmann J, Klein J, Fridman E, Skarda J, Srovnal J, Hajduch M, Murray P, Kolar Z.
BMC Cancer 2007 Mar; 7:55.
Application:IHC-P, Human, Human lobular and ductal invasive breast carcinomas.
-
The expression and function of epithelial membrane protein 1 in laryngeal carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com