ELK4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ELK4 protein.
Immunogen
ELK4 (NP_068567.1, 1 a.a. ~ 405 a.a) full-length human protein.
Sequence
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ELK4 MaxPab polyclonal antibody. Western Blot analysis of ELK4 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of ELK4 expression in transfected 293T cell line (H00002005-T03) by ELK4 MaxPab polyclonal antibody.
Lane 1: ELK4 transfected lysate(44.55 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ELK4 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ELK4
Entrez GeneID
2005GeneBank Accession#
NM_021795.2Protein Accession#
NP_068567.1Gene Name
ELK4
Gene Alias
SAP1
Gene Description
ELK4, ETS-domain protein (SRF accessory protein 1)
Omim ID
600246Gene Ontology
HyperlinkGene Summary
This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq
Other Designations
ELK4 protein|ETS-domain protein|OTTHUMP00000035339|SRF accessory protein 1
-
Interactome
-
Pathway
-
Publication Reference
-
ELK4 Promotes Colorectal Cancer Progression by Activating the Neoangiogenic Factor LRG1 in a Noncanonical SP1/3-Dependent Manner.
Zhehui Zhu, Yuegui Guo, Yun Liu, Rui Ding, Zhenyu Huang, Wei Yu, Long Cui, Peng Du, Ajay Goel, Chen-Ying Liu.
Advanced Science (Weinheim, Baden-Württemberg, Germany) 2023 Nov; 10(32):e2303378.
Application:PLA-Ce, Human, HCT116 cells.
-
ELK4 Promotes Colorectal Cancer Progression by Activating the Neoangiogenic Factor LRG1 in a Noncanonical SP1/3-Dependent Manner.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com