ELF5 monoclonal antibody (M01), clone 3D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ELF5 expression in transfected 293T cell line by ELF5 monoclonal antibody (M01), clone 3D10.
Lane 1: ELF5 transfected lysate(30.1 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ELF5 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ELF5.
Immunogen
ELF5 (NP_938195.1, 166 a.a. ~ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (100)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ELF5 expression in transfected 293T cell line by ELF5 monoclonal antibody (M01), clone 3D10.
Lane 1: ELF5 transfected lysate(30.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ELF5 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — ELF5
Entrez GeneID
2001GeneBank Accession#
NM_198381Protein Accession#
NP_938195.1Gene Name
ELF5
Gene Alias
ESE2
Gene Description
E74-like factor 5 (ets domain transcription factor)
Omim ID
605169Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
E74-like factor 5|epithelium-specific Ets transcription factor 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com