ELAVL4 monoclonal antibody (M01), clone 6B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ELAVL4 monoclonal antibody (M01), clone 6B9 Western Blot analysis of ELAVL4 expression in IMR-32 ( Cat # L008V1 ).
Western Blot (Cell lysate)
ELAVL4 monoclonal antibody (M01), clone 6B9. Western Blot analysis of ELAVL4 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9.
Lane 1: ELAVL4 transfected lysate(40.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ELAVL4 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi ( Cat # H00001996-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ELAVL4 monoclonal antibody (M01), clone 6B9 (Cat # H00001996-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (33.33 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ELAVL4.
Immunogen
ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ELAVL4 monoclonal antibody (M01), clone 6B9 Western Blot analysis of ELAVL4 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
ELAVL4 monoclonal antibody (M01), clone 6B9. Western Blot analysis of ELAVL4 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9.
Lane 1: ELAVL4 transfected lysate(40.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ELAVL4 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi ( Cat # H00001996-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ELAVL4 monoclonal antibody (M01), clone 6B9 (Cat # H00001996-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ELAVL4
Entrez GeneID
1996GeneBank Accession#
NM_021952Protein Accession#
NP_068771Gene Name
ELAVL4
Gene Alias
HUD, PNEM
Gene Description
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
Omim ID
168360Gene Ontology
HyperlinkGene Summary
abnormal vision
Other Designations
ELAV-like 4|Embryonic lethal, abnormal vision, Drosophila, homolog of, like-4|OTTHUMP00000009612
-
Interactome
-
Disease
-
Publication Reference
-
Analgesia and mouse strain influence neuromuscular plasticity in inflamed intestine.
Blennerhassett MG, Lourenssen SR, Parlow LRG, Ghasemlou N, Winterborn AN.
Neurogastroenterol Motil 2017 May; [Epub].
Application：IF, IHC-P, Mouse, Mouse colon.
-
Analgesia and mouse strain influence neuromuscular plasticity in inflamed intestine.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com