ELAVL3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ELAVL3 partial ORF ( NP_001411.2, 177 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
IEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAID
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.53
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ELAVL3
Entrez GeneID
1995GeneBank Accession#
NM_001420Protein Accession#
NP_001411.2Gene Name
ELAVL3
Gene Alias
DKFZp547J036, HUC, HUCL, MGC20653, PLE21
Gene Description
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C)
Omim ID
603458Gene Ontology
HyperlinkGene Summary
A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
ELAV-like protein 3|Hu antigen C|paraneoplastic cerebellar degeneration-associated antigen|paraneoplastic limbic encephalitis antigen 21
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com