EIF4G2 monoclonal antibody (M01), clone 3B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EIF4G2 monoclonal antibody (M01), clone 3B5 Western Blot analysis of EIF4G2 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
EIF4G2 monoclonal antibody (M01), clone 3B5. Western Blot analysis of EIF4G2 expression in PC-12 ( Cat # L012V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (34.43 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF4G2.
Immunogen
EIF4G2 (NP_001409, 811 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.43 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EIF4G2 monoclonal antibody (M01), clone 3B5 Western Blot analysis of EIF4G2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
EIF4G2 monoclonal antibody (M01), clone 3B5. Western Blot analysis of EIF4G2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — EIF4G2
Entrez GeneID
1982GeneBank Accession#
NM_001418Protein Accession#
NP_001409Gene Name
EIF4G2
Gene Alias
AAG1, DAP5, FLJ41344, NAT1, p97
Gene Description
eukaryotic translation initiation factor 4 gamma, 2
Omim ID
602325Gene Ontology
HyperlinkGene Summary
Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq
Other Designations
aging-associated protein 1|death-associated protein 5|eIF-4-gamma 2|eukaryotic translation initiation factor 4G-like 1
-
Interactome
-
Publication Reference
-
The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P.
Molecular & Cellular Proteomics 2014 Dec; 13(12):3585.
Application：WB-Ce, Human, PC-3 cells.
-
The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com