Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF4EBP2 (Human) Recombinant Protein (P01)

  • Catalog # : H00001979-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EIF4EBP2 full-length ORF ( AAH05057, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.94
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001979-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1979
  • Gene Name:
  • EIF4EBP2
  • Gene Alias:
  • 4EBP2,PHASII
  • Gene Description:
  • eukaryotic translation initiation factor 4E binding protein 2
  • Gene Summary:
  • This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019756,phosphorylated, heat and acid stable regulated by insulin protein II
  • RSS
  • YouTube
  • Linkedin
  • Facebook