Product Browser

Last updated: 2017/11/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF4EBP2 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00001979-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human EIF4EBP2 protein.
  • Immunogen:
  • EIF4EBP2 (AAH05057, 1 a.a. ~ 120 a.a) full-length human protein.
  • Sequence:
  • MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EIF4EBP2 expression in transfected 293T cell line (H00001979-T01) by EIF4EBP2 MaxPab polyclonal antibody.

    Lane 1: EIF4EBP2 transfected lysate(13.31 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1979
  • Gene Name:
  • EIF4EBP2
  • Gene Alias:
  • 4EBP2,PHASII
  • Gene Description:
  • eukaryotic translation initiation factor 4E binding protein 2
  • Gene Summary:
  • This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019756,phosphorylated, heat and acid stable regulated by insulin protein II
  • RSS
  • YouTube
  • Linkedin
  • Facebook