EGR1 monoclonal antibody (M03), clone 6E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EGR1.
Immunogen
EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (87); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody (M03), clone 6E8.
Lane 1: EGR1 transfected lysate(59.73 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EGR1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EGR1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EGR1
Entrez GeneID
1958GeneBank Accession#
NM_001964Protein Accession#
NP_001955Gene Name
EGR1
Gene Alias
AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Gene Description
early growth response 1
Omim ID
128990Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. [provided by RefSeq
Other Designations
early growth response protein 1|nerve growth factor-induced protein A|transcription factor ETR103|zinc finger protein 225
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A novel EGR-1 dependent mechanism for YB-1 modulation of paclitaxel response in a triple negative breast cancer cell line.
Lasham A, Mehta SY, Fitzgerald SJ, Woolley AG, Hearn JI, Hurley DG, Ruza I, Algie M, Shelling AN, Braithwaite AW, Print CG.
International Journal of Cancer 2016 May; 139(5):1157.
Application:IHC, Human, MDA-MB-231.
-
Induction of hypertrophy in vitro by mechanical loading in adult rabbit myocardium.
Bupha-Intr T, Holmes JW, Janssen PM.
American Journal of Physiology. Heart and Circulatory Physiology 2007 Oct; 293(6):H3759.
Application:WB, Rabbit, Rabbit myocardium.
-
A novel EGR-1 dependent mechanism for YB-1 modulation of paclitaxel response in a triple negative breast cancer cell line.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com