EGR1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant EGR1.
Immunogen
EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag.
Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (87); Rat (89)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EGR1 polyclonal antibody (A01), Lot # . Western Blot analysis of EGR1 expression in Raw 264.7.Western Blot (Cell lysate)
EGR1 polyclonal antibody (A01), Lot # . Western Blot analysis of EGR1 expression in PC-12.Western Blot (Cell lysate)
EGR1 polyclonal antibody (A01), Lot # TTB0060123QCS1 Western Blot analysis of EGR1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — EGR1
Entrez GeneID
1958GeneBank Accession#
NM_001964Protein Accession#
NP_001955Gene Name
EGR1
Gene Alias
AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225
Gene Description
early growth response 1
Omim ID
128990Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. [provided by RefSeq
Other Designations
early growth response protein 1|nerve growth factor-induced protein A|transcription factor ETR103|zinc finger protein 225
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Progesterone-dependent deoxyribonucleic acid looping between RUSH/SMARCA3 and Egr-1 mediates repression by c-Rel.
Hewetson A, Chilton BS.
Molecular Endocrinology 2008 Jan; 22(4):813.
Application:Array, WB, Rabbit, HRE-H9 cells.
-
Progesterone-dependent deoxyribonucleic acid looping between RUSH/SMARCA3 and Egr-1 mediates repression by c-Rel.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com