Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CELSR3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001951-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CELSR3 partial ORF ( NP_001398, 71 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001951-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1951
  • Gene Name:
  • CELSR3
  • Gene Alias:
  • CDHF11,EGFL1,FMI1,HFMI1,MEGF2,RESDA1
  • Gene Description:
  • cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)
  • Gene Summary:
  • The protein encoded by this gene is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions. The specific function of this particular member has not been determined. [provided by RefSeq
  • Other Designations:
  • EGF-like-domain, multiple 1,anchor protein,cadherin EGF LAG seven-pass G-type receptor 3,epidermal growth factor-like 1,multiple EGF-like domains 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook