Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EFNA1 (Human) Recombinant Protein (P01)

  • Catalog # : H00001942-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EFNA1 full-length ORF ( NP_004419.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001942-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1942
  • Gene Name:
  • EFNA1
  • Gene Alias:
  • B61,ECKLG,EFL1,EPLG1,LERK1,TNFAIP4
  • Gene Description:
  • ephrin-A1
  • Gene Summary:
  • This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000033242,OTTHUMP00000033271,eph-related receptor tyrosine kinase ligand 1,ephrin A1,immediate early response protein B61,ligand of eph-related kinase 1,tumor necrosis factor, alpha-induced protein 4
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook