EIF2D monoclonal antibody (M05), clone 2D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF2D.
Immunogen
EIF2D (NP_008824.2, 485 a.a. ~ 584 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EIF2D monoclonal antibody (M05), clone 2D10. Western Blot analysis of EIF2D expression in human liver.Western Blot (Cell lysate)
EIF2D monoclonal antibody (M05), clone 2D10. Western Blot analysis of EIF2D expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of EIF2D expression in transfected 293T cell line by EIF2D monoclonal antibody (M05), clone 2D10.
Lane 1: EIF2D transfected lysate (Predicted MW: 64.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF2D is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — EIF2D
Entrez GeneID
1939GeneBank Accession#
NM_006893Protein Accession#
NP_008824.2Gene Name
EIF2D
Gene Alias
LGTN; HCA56
Gene Description
eukaryotic translation initiation factor 2D
Omim ID
151625Gene Ontology
HyperlinkGene Summary
This gene encodes a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively. [provided by RefSeq
Other Designations
Hepatocellular carcinoma-associated antigen 56|OTTHUMP00000034537
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com