EEF1G monoclonal antibody (M01), clone 3F11-1A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant EEF1G.
Immunogen
EEF1G (AAH15813.1, 1 a.a. ~ 437 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYHVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHDKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (73.59 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
EEF1G monoclonal antibody (M01), clone 3F11-1A10 Western Blot analysis of EEF1G expression in HL-60 ( Cat # L014V1 ).Western Blot (Cell lysate)
EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
EEF1G monoclonal antibody (M01), clone 3F11-1A10. Western Blot analysis of EEF1G expression in 293 ( Cat # L026V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EEF1G expression in transfected 293T cell line by EEF1G monoclonal antibody (M01), clone 3F11-1A10.
Lane 1: EEF1G transfected lysate(50 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of EEF1G over-expressed 293 cell line, cotransfected with EEF1G Validated Chimera RNAi ( Cat # H00001937-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with EEF1G monoclonal antibody (M01), clone 3F11-1A10 (Cat # H00001937-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to EEF1G on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — EEF1G
Entrez GeneID
1937GeneBank Accession#
BC015813Protein Accession#
AAH15813.1Gene Name
EEF1G
Gene Alias
EF1G, GIG35
Gene Description
eukaryotic translation elongation factor 1 gamma
Omim ID
130593Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq
Other Designations
EF-1-gamma|PRO1608|eEF-1B gamma|elongation factor 1-gamma|pancreatic tumor-related protein|translation elongation factor eEF-1 gamma chain
-
Interactome
-
Publication Reference
-
The eEF1 gamma Subunit Contacts RNA Polymerase II and Binds Vimentin Promoter Region.
Corbi N, Batassa EM, Pisani C, Onori A, Di Certo MG, Strimpakos G, Fanciulli M, Mattei E, Passananti C.
PLoS One 2010 Dec; 5(12):e14481.
Application:IF, Human, HeLa cells.
-
The eEF1 gamma Subunit Contacts RNA Polymerase II and Binds Vimentin Promoter Region.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com