EEF1D monoclonal antibody (M04), clone 4B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EEF1D monoclonal antibody (M04), clone 4B12. Western Blot analysis of EEF1D expression in human pancreas.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EEF1D is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to EEF1D on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EEF1D.
Immunogen
EEF1D (NP_115754, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EEF1D monoclonal antibody (M04), clone 4B12. Western Blot analysis of EEF1D expression in human pancreas.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EEF1D is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EEF1D on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — EEF1D
Entrez GeneID
1936GeneBank Accession#
NM_032378Protein Accession#
NP_115754Gene Name
EEF1D
Gene Alias
EF-1D, EF1D, FLJ20897, FP1047
Gene Description
eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
Omim ID
130592Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq
Other Designations
antigen NY-CO-4|eukaryotic translation elongation factor 1 delta|guanine nucleotide exchange protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com