EEF1B2 monoclonal antibody (M14), clone 2G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in Raw 264.7.
Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in PC-12.
Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in NIH/3T3.
Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in HepG2.
Western Blot detection against Immunogen (50.49 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant EEF1B2.
Immunogen
EEF1B2 (AAH00211, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGADMLEEQITAFEDYVQSMDVAAFNKI
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (50.49 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in Raw 264.7.Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in PC-12.Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in NIH/3T3.Western Blot (Cell lysate)
EEF1B2 monoclonal antibody (M14), clone 2G6. Western Blot analysis of EEF1B2 expression in HepG2.Western Blot (Recombinant protein)
ELISA
-
Gene Info — EEF1B2
Entrez GeneID
1933GeneBank Accession#
BC000211Protein Accession#
AAH00211Gene Name
EEF1B2
Gene Alias
EEF1B, EEF1B1, EF1B
Gene Description
eukaryotic translation elongation factor 1 beta 2
Omim ID
600655Gene Ontology
HyperlinkGene Summary
This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq
Other Designations
OTTHUMP00000163805|eukaryotic translation elongation factor 1 beta 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com