Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EEF1A2 polyclonal antibody (A01)

  • Catalog # : H00001917-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EEF1A2.
  • Immunogen:
  • EEF1A2 (NP_001949, 364 a.a. ~ 462 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001917-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in human thyroid(diffuse hyperplasia).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb Western Blot analysis of EEF1A2 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EEF1A2 polyclonal antibody (A01), Lot # 070201JCSb. Western Blot analysis of EEF1A2 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1917
  • Gene Name:
  • EEF1A2
  • Gene Alias:
  • EEF1AL,EF-1-alpha-2,EF1A,FLJ41696,HS1,STN,STNL
  • Gene Description:
  • eukaryotic translation elongation factor 1 alpha 2
  • Gene Summary:
  • This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031776,elongation factor 1-alpha 2,elongation factor-1 alpha,statin S1,statin-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook