EEF1A1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EEF1A1 partial ORF ( AAH09875, 156 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EEF1A1
Entrez GeneID
1915GeneBank Accession#
BC009875Protein Accession#
AAH09875Gene Name
EEF1A1
Gene Alias
CCS-3, CCS3, EEF-1, EEF1A, EF-Tu, EF1A, FLJ25721, GRAF-1EF, HNGC:16303, LENG7, MGC102687, MGC131894, MGC16224, PTI1, eEF1A-1
Gene Description
eukaryotic translation elongation factor 1 alpha 1
Omim ID
130590Gene Ontology
HyperlinkGene Summary
This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq
Other Designations
CTCL tumor antigen|EF1a-like protein|OTTHUMP00000016736|OTTHUMP00000063804|OTTHUMP00000063805|cervical cancer suppressor 3|elongation factor 1 alpha subunit|elongation factor 1-alpha|elongation factor Tu|eukaryotic translation elongation factor 1 alpha 1-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com