Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EEF1A1 polyclonal antibody (A01)

  • Catalog # : H00001915-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EEF1A1.
  • Immunogen:
  • EEF1A1 (AAH09875, 156 a.a. ~ 255 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001915-A01
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EEF1A1 polyclonal antibody (A01). Western Blot analysis of EEF1A1 expression in K-562.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1915
  • Gene Name:
  • EEF1A1
  • Gene Alias:
  • CCS-3,CCS3,EEF-1,EEF1A,EF-Tu,EF1A,FLJ25721,GRAF-1EF,HNGC:16303,LENG7,MGC102687,MGC131894,MGC16224,PTI1,eEF1A-1
  • Gene Description:
  • eukaryotic translation elongation factor 1 alpha 1
  • Gene Summary:
  • This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq
  • Other Designations:
  • CTCL tumor antigen,EF1a-like protein,OTTHUMP00000016736,OTTHUMP00000063804,OTTHUMP00000063805,cervical cancer suppressor 3,elongation factor 1 alpha subunit,elongation factor 1-alpha,elongation factor Tu,eukaryotic translation elongation factor 1 alpha 1-
  • RSS
  • YouTube
  • Linkedin
  • Facebook