PHC1 monoclonal antibody (M05), clone 3G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PHC1 monoclonal antibody (M05), clone 3G1. Western Blot analysis of PHC1 expression in MCF-7.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHC1 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PHC1.
Immunogen
PHC1 (NP_004417, 751 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANY*
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PHC1 monoclonal antibody (M05), clone 3G1. Western Blot analysis of PHC1 expression in MCF-7.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PHC1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — PHC1
Entrez GeneID
1911GeneBank Accession#
NM_004426Protein Accession#
NP_004417Gene Name
PHC1
Gene Alias
EDR1, HPH1, RAE28
Gene Description
polyhomeotic homolog 1 (Drosophila)
Omim ID
602978Gene Ontology
HyperlinkGene Summary
This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein. [provided by RefSeq
Other Designations
Rae28-like|early development regulator 1 (homolog of polyhomeotic 1)|polyhomeotic 1-like|polyhomeotic-like 1
-
Interactome
-
Publication Reference
-
Cardiogenol C can induce Mouse Hair Bulge Progenitor Cells to Transdifferentiate into Cardiomyocyte-like Cells.
Yau WW, Tang MK, Chen E, Yao Y, Wong IW, Lee HS, Lee KK.
Proteome Science 2011 Jan; 9(1):3.
Application：WB-Ce, Mouse, Mouse hair bulge progenitor cells.
-
Cardiogenol C can induce Mouse Hair Bulge Progenitor Cells to Transdifferentiate into Cardiomyocyte-like Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com