EDN3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
EDN3 MaxPab rabbit polyclonal antibody. Western Blot analysis of EDN3 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of EDN3 expression in transfected 293T cell line (H00001908-T01) by EDN3 MaxPab polyclonal antibody.
Lane 1: EDN3 transfected lysate(25.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human EDN3 protein.
Immunogen
EDN3 (NP_000105.1, 1 a.a. ~ 238 a.a) full-length human protein.
Sequence
MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EDN3 MaxPab rabbit polyclonal antibody. Western Blot analysis of EDN3 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of EDN3 expression in transfected 293T cell line (H00001908-T01) by EDN3 MaxPab polyclonal antibody.
Lane 1: EDN3 transfected lysate(25.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EDN3
Entrez GeneID
1908GeneBank Accession#
NM_000114.2Protein Accession#
NP_000105.1Gene Name
EDN3
Gene Alias
ET3, MGC15067, MGC61498
Gene Description
endothelin 3
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000031420|truncated endothelin 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com