EDN1 monoclonal antibody (M01), clone 3D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EDN1.
Immunogen
EDN1 (AAH09720, 113 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Host
Mouse
Reactivity
Human
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EDN1 expression in transfected 293T cell line by EDN1 monoclonal antibody (M01), clone 3D6.
Lane 1: EDN1 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of EDN1 transfected lysate using anti-EDN1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EDN1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — EDN1
-
Interactome
-
Pathway
-
Disease
- Abortion
- Albuminuria
- Altitude Sickness
- Alzheimer disease
- Anemia
- Angina Pectoris
- Anoxia
- Arrhythmias
- Arthritis
+ View More Disease
-
Publication Reference
-
Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma.
Marion A, Dieudonné FX, Patiño-Garcia A, Lecanda F, Marie PJ, Modrowski D.
International Journal of Cancer 2012 Jun; 30(11):2514.
Application:WB-Tr, Human, U2OS cells.
-
Endothelin type A and B receptors in the control of afferent and efferent arterioles in mice.
Schildroth J, Rettig-Zimmermann J, Kalk P, Steege A, Fahling M, Sendeski M, Paliege A, Lai EY, Bachmann S, Persson PB, Hocher B, Patzak A.
Nephrology, Dialysis, Transplantation: Official Publication of the European Dialysis 2011 Mar; 26(3):779.
Application:WB-Ti, Mouse, Mouse kidneys.
-
Epithelial-to-Mesenchymal Transition and Resistance to Ingenol 3-Angelate, a Novel Protein Kinase C Modulator, in Colon Cancer Cells.
Ghoul A, Serova M, Astorgues-Xerri L, Bieche I, Bousquet G, Varna M, Vidaud M, Phillips E, Weill S, Benhadji KA, Lokiec F, Cvitkovic E, Faivre S, Raymond E.
Cancer Research 2009 May; 69(10):4260.
Application:IF, WB-Ce, Human, Colo205-S, Colo205-R cells.
-
Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com