Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDG3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001903-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EDG3 partial ORF ( NP_005217.2, 302 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.21
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001903-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1903
  • Gene Name:
  • S1PR3
  • Gene Alias:
  • EDG-3,EDG3,FLJ37523,FLJ93220,LPB3,MGC71696,S1P3
  • Gene Description:
  • sphingosine-1-phosphate receptor 3
  • Gene Summary:
  • This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq
  • Other Designations:
  • G protein-coupled receptor, endothelial differentiation gene-3,OTTHUMP00000021612,S1P receptor EDG3,endothelial differentiation, sphingolipid G-protein-coupled receptor, 3,sphingosine 1-phosphate receptor 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook