EDG3 monoclonal antibody (M02), clone 2G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EDG3.
Immunogen
EDG3 (NP_005217.2, 302 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to S1PR3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged S1PR3 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — S1PR3
Entrez GeneID
1903GeneBank Accession#
NM_005226Protein Accession#
NP_005217.2Gene Name
S1PR3
Gene Alias
EDG-3, EDG3, FLJ37523, FLJ93220, LPB3, MGC71696, S1P3
Gene Description
sphingosine-1-phosphate receptor 3
Omim ID
601965Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq
Other Designations
G protein-coupled receptor, endothelial differentiation gene-3|OTTHUMP00000021612|S1P receptor EDG3|endothelial differentiation, sphingolipid G-protein-coupled receptor, 3|sphingosine 1-phosphate receptor 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
S1PR3 is essential for phosphorylated fingolimod to protect astrocytes against oxygen-glucose deprivation-induced neuroinflammation via inhibiting TLR2/4-NFκB signalling.
Dong YF, Guo RB, Ji J, Cao LL, Zhang L, Chen ZZ, Huang JY, Wu J, Lu J, Sun XL.
Journal of Cellular and Molecular Medicine 2018 Jun; 22(6):3159.
Application:WB, Rat, Rat astrocytes.
-
S1PR3 is essential for phosphorylated fingolimod to protect astrocytes against oxygen-glucose deprivation-induced neuroinflammation via inhibiting TLR2/4-NFκB signalling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com