Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDA monoclonal antibody (M16), clone 4D9

  • Catalog # : H00001896-M16
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant EDA.
  • Immunogen:
  • EDA (NP_001005609.1, 245 a.a. ~ 389 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1896
  • Gene Name:
  • EDA
  • Gene Alias:
  • ED1,ED1-A1,ED1-A2,EDA1,EDA2,HED,XHED,XLHED
  • Gene Description:
  • ectodysplasin A
  • Gene Summary:
  • The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023461,OTTHUMP00000023463,X-linked anhidroitic ectodermal dysplasia protein,ectodermal dysplasia 1, anhidrotic,ectodermal dysplasia, anhidrotic (hypohydrotic),ectodysplasin-A
  • RSS
  • YouTube
  • Linkedin
  • Facebook