ECH1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ECH1 MaxPab polyclonal antibody. Western Blot analysis of ECH1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of ECH1 expression in transfected 293T cell line (H00001891-T01) by ECH1 MaxPab polyclonal antibody.
Lane 1: ECH1 transfected lysate(36.08 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ECH1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ECH1 protein.
Immunogen
ECH1 (NP_001389.2, 1 a.a. ~ 328 a.a) full-length human protein.
Sequence
MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ECH1 MaxPab polyclonal antibody. Western Blot analysis of ECH1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of ECH1 expression in transfected 293T cell line (H00001891-T01) by ECH1 MaxPab polyclonal antibody.
Lane 1: ECH1 transfected lysate(36.08 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ECH1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ECH1
Entrez GeneID
1891GeneBank Accession#
NM_001398.2Protein Accession#
NP_001389.2Gene Name
ECH1
Gene Alias
HPXEL
Gene Description
enoyl Coenzyme A hydratase 1, peroxisomal
Omim ID
600696Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. [provided by RefSeq
Other Designations
delta3,5-delta2,4-dienoyl-CoA isomerase|dienoyl-CoA isomerase|peroxisomal enoyl-CoA hydratase 1|peroxisomal enoyl-coenzyme A hydratase-like protein
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com