DVL3 monoclonal antibody (M04), clone 4H2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DVL3.
Immunogen
DVL3 (AAH32459, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DVL3 monoclonal antibody (M04), clone 4H2 Western Blot analysis of DVL3 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DVL3 expression in transfected 293T cell line by DVL3 monoclonal antibody (M04), clone 4H2.
Lane 1: DVL3 transfected lysate(78 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DVL3 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DVL3 over-expressed 293 cell line, cotransfected with DVL3 Validated Chimera RNAi ( Cat # H00001857-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DVL3 monoclonal antibody (M04), clone 4H2 (Cat # H00001857-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to DVL3 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — DVL3
Entrez GeneID
1857GeneBank Accession#
BC032459Protein Accession#
AAH32459Gene Name
DVL3
Gene Alias
KIAA0208
Gene Description
dishevelled, dsh homolog 3 (Drosophila)
Omim ID
601368Gene Ontology
HyperlinkGene Summary
This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation. [provided by RefSeq
Other Designations
dishevelled 3|dishevelled 3 (homologous to Drosophila dsh)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com