DUSP5 monoclonal antibody (M04), clone 2F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DUSP5.
Immunogen
DUSP5 (NP_004410, 286 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DUSP5 monoclonal antibody (M04), clone 2F3 Western Blot analysis of DUSP5 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DUSP5 expression in transfected 293T cell line by DUSP5 monoclonal antibody (M04), clone 2F3.
Lane 1: DUSP5 transfected lysate (Predicted MW: 42.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DUSP5 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DUSP5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DUSP5
Entrez GeneID
1847GeneBank Accession#
NM_004419Protein Accession#
NP_004410Gene Name
DUSP5
Gene Alias
DUSP, HVH3
Gene Description
dual specificity phosphatase 5
Omim ID
603069Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. [provided by RefSeq
Other Designations
OTTHUMP00000020476|VH1-like phosphatase 3|serine/threonine specific protein phosphatase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Zinc-Finger Nuclease Knockout of Dual-Specificity Protein Phosphatase-5 Enhances the Myogenic Response and Autoregulation of Cerebral Blood Flow in FHH.1BN Rats.
Fan F, Geurts AM, Pabbidi MR, Smith SV, Harder DR, Jacob H, Roman RJ.
PLoS One 2014 Nov; 9(11):e112878.
Application:WB-Ti, Rat, Cerebral microvessels, Liver, Brain, Spleen.
-
Zinc-Finger Nuclease Knockout of Dual-Specificity Protein Phosphatase-5 Enhances the Myogenic Response and Autoregulation of Cerebral Blood Flow in FHH.1BN Rats.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com