DUSP1 monoclonal antibody (M05), clone 3A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DUSP1.
Immunogen
DUSP1 (NP_004408, 305 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.67 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DUSP1 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DUSP1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DUSP1
Entrez GeneID
1843GeneBank Accession#
NM_004417Protein Accession#
NP_004408Gene Name
DUSP1
Gene Alias
CL100, HVH1, MKP-1, MKP1, PTPN10
Gene Description
dual specificity phosphatase 1
Omim ID
600714Gene Ontology
HyperlinkGene Summary
The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq
Other Designations
serine/threonine specific protein phosphatase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Growth Hormone Releasing Peptide-2 Attenuation of Protein Kinase C-Induced Inflammation in Human Ovarian Granulosa Cells.
Chao YN, Sun D, Peng YC, Wu YL.
International Journal of Molecular Sciences 2016 Aug; 17(8).
Application:WB-Ce, Human, Human ovarian granulosa cell KGN.
-
DUSP5 and DUSP6 modulate corneal epithelial cell proliferation.
Zheng Wang, Peter S Reinach, Fan Zhang, Kati-Sisko Vellonen, Arto Urtti, Helen Turner, J Mario Wolosin.
Molecular Vision 2010 Aug; 16:1696.
Application:WB-Tr, Human, Human corneal epithelial cells.
-
Growth Hormone Releasing Peptide-2 Attenuation of Protein Kinase C-Induced Inflammation in Human Ovarian Granulosa Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com