DTNA purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human DTNA protein.
Immunogen
DTNA (AAH05300.1, 1 a.a. ~ 371 a.a) full-length human protein.
Sequence
MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSSDGAFGGCV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DTNA expression in transfected 293T cell line (H00001837-T03) by DTNA MaxPab polyclonal antibody.
Lane 1: DTNA transfected lysate(40.92 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DTNA on HeLa cell. [antibody concentration 10 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to DTNA on 293T cell. [antibody concentration 1 ug/ml] -
Gene Info — DTNA
Entrez GeneID
1837GeneBank Accession#
BC005300.1Protein Accession#
AAH05300.1Gene Name
DTNA
Gene Alias
D18S892E, DRP3, DTN, FLJ96209, LVNC1
Gene Description
dystrobrevin, alpha
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000163154|OTTHUMP00000163155|dystrobrevin alpha|dystrophin-related protein 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com