SLC26A2 monoclonal antibody (M04), clone 3F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SLC26A2 expression in transfected 293T cell line by SLC26A2 monoclonal antibody (M04), clone 3F6.
Lane 1: SLC26A2 transfected lysate(81.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC26A2 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SLC26A2.
Immunogen
SLC26A2 (NP_000103.1, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (56); Rat (56)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SLC26A2 expression in transfected 293T cell line by SLC26A2 monoclonal antibody (M04), clone 3F6.
Lane 1: SLC26A2 transfected lysate(81.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC26A2 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC26A2
Entrez GeneID
1836GeneBank Accession#
NM_000112Protein Accession#
NP_000103.1Gene Name
SLC26A2
Gene Alias
D5S1708, DTD, DTDST, EDM4, MST153, MSTP157
Gene Description
solute carrier family 26 (sulfate transporter), member 2
Gene Ontology
HyperlinkGene Summary
The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization. [provided by RefSeq
Other Designations
diastrophic dysplasia sulfate transporter|solute carrier family 26 member 2|sulfate anion transporter 1
-
Interactome
-
Disease
-
Publication Reference
-
Epigenetic Silencing of the Sulfate Transporter Gene DTDST Induces Sialyl Lewisx Expression and Accelerates Proliferation of Colon Cancer Cells.
Yusa A, Miyazaki K, Kimura N, Izawa M, Kannagi R.
Cancer Research 2010 May; 70(10):4064.
Application：IHC-Fr, Human, Human colon cancer.
-
Epigenetic Silencing of the Sulfate Transporter Gene DTDST Induces Sialyl Lewisx Expression and Accelerates Proliferation of Colon Cancer Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com