Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TSC22D3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001831-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TSC22D3 partial ORF ( NP_932174, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.41
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001831-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1831
  • Gene Name:
  • TSC22D3
  • Gene Alias:
  • DIP,DKFZp313A1123,DSIPI,GILZ,TSC-22R,hDIP
  • Gene Description:
  • TSC22 domain family, member 3
  • Gene Summary:
  • The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • DSIP-immunoreactive leucine zipper protein,OTTHUMP00000023811,OTTHUMP00000023813,OTTHUMP00000023814,TSC-22 related protein,delta sleep inducing peptide, immunoreactor,glucocorticoid-induced leucine zipper protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook