Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DSCR1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00001827-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DSCR1 protein.
  • Immunogen:
  • DSCR1 (NP_981962.1, 1 a.a. ~ 117 a.a) full-length human protein.
  • Sequence:
  • MKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RCAN1 expression in transfected 293T cell line (H00001827-T01) by RCAN1 MaxPab polyclonal antibody.

    Lane 1: DSCR1 transfected lysate(12.87 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1827
  • Gene Name:
  • RCAN1
  • Gene Alias:
  • ADAPT78,CSP1,DSC1,DSCR1,MCIP1,RCN1
  • Gene Description:
  • regulator of calcineurin 1
  • Gene Summary:
  • The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Down syndrome candidate region 1,Down syndrome critical region gene 1,calcipressin 1,calcium and oxidant-inducible mRNA,modulatory calcineurin-interacting protein 1,myocyte-enriched calcineurin-interacting protein 1,near DSCR proline-rich protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook