Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARID3A (Human) Recombinant Protein (Q01)

  • Catalog # : H00001820-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARID3A partial ORF ( NP_005215, 317 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001820-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1820
  • Gene Name:
  • ARID3A
  • Gene Alias:
  • BRIGHT,DRIL1,DRIL3,E2FBP1
  • Gene Description:
  • AT rich interactive domain 3A (BRIGHT-like)
  • Gene Summary:
  • This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq
  • Other Designations:
  • ARID domain-containing 3A,AT rich interactive domain 3A (BRIGHT- like),AT rich interactive domain 3A (BRIGHT- like) protein,B-cell regulator of IgH transcription,E2F-binding protein 1,dead ringer-like 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook