Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARID3A polyclonal antibody (A01)

  • Catalog # : H00001820-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ARID3A.
  • Immunogen:
  • ARID3A (NP_005215, 317 a.a. ~ 416 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001820-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1820
  • Gene Name:
  • ARID3A
  • Gene Alias:
  • BRIGHT,DRIL1,DRIL3,E2FBP1
  • Gene Description:
  • AT rich interactive domain 3A (BRIGHT-like)
  • Gene Summary:
  • This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. [provided by RefSeq
  • Other Designations:
  • ARID domain-containing 3A,AT rich interactive domain 3A (BRIGHT- like),AT rich interactive domain 3A (BRIGHT- like) protein,B-cell regulator of IgH transcription,E2F-binding protein 1,dead ringer-like 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook