Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DPP6 (Human) Recombinant Protein (P01)

  • Catalog # : H00001804-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DPP6 full-length ORF (1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MELAALGLSPCPRLLHAELLPGLLTVFSLRFLQDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQVQYACYSVLNLEQDIPFMEKDLTGVQGLLLQQTRLCCGGRC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 46.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1804
  • Gene Name:
  • DPP6
  • Gene Alias:
  • DPPX,MGC46605
  • Gene Description:
  • dipeptidyl-peptidase 6
  • Gene Summary:
  • This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • dipeptidyl aminopeptidase IV-related protein,dipeptidyl aminopeptidase-like protein 6,dipeptidyl peptidase IV-related protein,dipeptidylpeptidase 6,dipeptidylpeptidase VI
  • RSS
  • YouTube
  • Linkedin
  • Facebook