Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DPP4 polyclonal antibody (A01)

  • Catalog # : H00001803-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DPP4.
  • Immunogen:
  • DPP4 (AAH65265, 352 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSRELNP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001803-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1803
  • Gene Name:
  • DPP4
  • Gene Alias:
  • ADABP,ADCP2,CD26,DPPIV,TP103
  • Gene Description:
  • dipeptidyl-peptidase 4
  • Gene Summary:
  • The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. [provided by RefSeq
  • Other Designations:
  • T-cell activation antigen CD26,adenosine deaminase complexing protein 2,dipeptidylpeptidase 4,dipeptidylpeptidase IV,dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2)
  • RSS
  • YouTube
  • Linkedin
  • Facebook