DPH1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DPH1 partial ORF ( NP_001374, 216 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Interspecies Antigen Sequence
Mouse (93); Rat (91)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DPH1
Entrez GeneID
1801GeneBank Accession#
NM_001383Protein Accession#
NP_001374Gene Name
DPH1
Gene Alias
DPH2L, DPH2L1, FLJ33211, OVCA1
Gene Description
DPH1 homolog (S. cerevisiae)
Omim ID
603527Gene Ontology
HyperlinkGene Summary
Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM
Other Designations
DPH-like 1|DPH2-like 1|candidate tumor suppressor in ovarian cancer 1|diptheria toxin resistance protein required for diphthamide biosynthesis (Saccharomyces)-like 1|diptheria toxin resistance protein required for diphthamide biosynthesis-like 1|ovarian c
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com