Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DPH1 monoclonal antibody (M02), clone 2C5

  • Catalog # : H00001801-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DPH1.
  • Immunogen:
  • DPH1 (NP_001374, 216 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLESRLRALGLSFVRLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DPH1 monoclonal antibody (M02), clone 2C5 Western Blot analysis of DPH1 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1801
  • Gene Name:
  • DPH1
  • Gene Alias:
  • DPH2L,DPH2L1,FLJ33211,OVCA1
  • Gene Description:
  • DPH1 homolog (S. cerevisiae)
  • Gene Summary:
  • Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM
  • Other Designations:
  • DPH-like 1,DPH2-like 1,candidate tumor suppressor in ovarian cancer 1,diptheria toxin resistance protein required for diphthamide biosynthesis (Saccharomyces)-like 1,diptheria toxin resistance protein required for diphthamide biosynthesis-like 1,ovarian c
  • RSS
  • YouTube
  • Linkedin
  • Facebook