Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DPAGT1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001798-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DPAGT1 partial ORF ( NP_001373, 296 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.76
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001798-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1798
  • Gene Name:
  • DPAGT1
  • Gene Alias:
  • ALG7,CDG-Ij,D11S366,DGPT,DPAGT,DPAGT2,G1PT,GPT,UAGT,UGAT
  • Gene Description:
  • dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase)
  • Gene Summary:
  • The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme. [provided by RefSeq
  • Other Designations:
  • GlcNAc-1-P transferase,N-acetylglucosamine-1-phosphate transferase,UDP-GlcNAc:dolichyl-phosphate N-acetylglucosaminephosphotransferase,UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase,dolichyl-phosphate alpha-N-acetylglucos
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook