DNTT monoclonal antibody (M01), clone 4H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DNTT expression in transfected 293T cell line by DNTT monoclonal antibody (M01), clone 4H5.
Lane 1: DNTT transfected lysate (Predicted MW: 58.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DNTT is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.51 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DNTT.
Immunogen
DNTT (AAH12920, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (83)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DNTT expression in transfected 293T cell line by DNTT monoclonal antibody (M01), clone 4H5.
Lane 1: DNTT transfected lysate (Predicted MW: 58.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DNTT is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — DNTT
Entrez GeneID
1791GeneBank Accession#
BC012920Protein Accession#
AAH12920Gene Name
DNTT
Gene Alias
TDT
Gene Description
deoxynucleotidyltransferase, terminal
Omim ID
187410Gene Ontology
HyperlinkGene Summary
This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq
Other Designations
DNA nucleotidylexotransferase|OTTHUMP00000020171|nucleosidetriphosphate:DNA deoxynucleotidylexotransferase|terminal addition enzyme|terminal deoxynucleotidyltransferase|terminal deoxyribonucleotidyltransferase|terminal transferase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com