Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNMT3A (Human) Recombinant Protein (Q01)

  • Catalog # : H00001788-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DNMT3A partial ORF ( AAH43617, 803 a.a. - 912 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.95
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001788-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1788
  • Gene Name:
  • DNMT3A
  • Gene Alias:
  • DNMT3A2,M.HsaIIIA
  • Gene Description:
  • DNA (cytosine-5-)-methyltransferase 3 alpha
  • Gene Summary:
  • CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • DNA MTase HsaIIIA,DNA cytosine methyltransferase 3 alpha,DNA cytosine methyltransferase 3A2,DNA methyltransferase HsaIIIA,OTTHUMP00000120005,OTTHUMP00000120006
  • RSS
  • YouTube
  • Linkedin
  • Facebook