Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00001778-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human DYNC1H1 protein.
  • Immunogen:
  • DYNC1H1 (AAH64521.1, 1 a.a. ~ 197 a.a) full-length human protein.
  • Sequence:
  • MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DYNC1H1 expression in transfected 293T cell line (H00001778-T03) by DYNC1H1 MaxPab polyclonal antibody.

    Lane 1: DYNC1H1 transfected lysate(22.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1778
  • Gene Name:
  • DYNC1H1
  • Gene Alias:
  • DHC1,DHC1a,DKFZp686P2245,DNCH1,DNCL,DNECL,DYHC,Dnchc1,HL-3,KIAA0325,p22
  • Gene Description:
  • dynein, cytoplasmic 1, heavy chain 1
  • Gene Summary:
  • Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family. [provided by RefSeq
  • Other Designations:
  • cytoplasmic dynein 1 heavy chain 1,dynein heavy chain, cytosolic,dynein, cytoplasmic, heavy polypeptide 1,dynein, cytoplasmic-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook