DYNC1H1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DYNC1H1 protein.
Immunogen
DYNC1H1 (AAH64521.1, 1 a.a. ~ 197 a.a) full-length human protein.
Sequence
MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DYNC1H1 expression in transfected 293T cell line (H00001778-T03) by DYNC1H1 MaxPab polyclonal antibody.
Lane 1: DYNC1H1 transfected lysate(22.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DYNC1H1
Entrez GeneID
1778GeneBank Accession#
BC064521Protein Accession#
AAH64521.1Gene Name
DYNC1H1
Gene Alias
DHC1, DHC1a, DKFZp686P2245, DNCH1, DNCL, DNECL, DYHC, Dnchc1, HL-3, KIAA0325, p22
Gene Description
dynein, cytoplasmic 1, heavy chain 1
Omim ID
600112Gene Ontology
HyperlinkGene Summary
Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family. [provided by RefSeq
Other Designations
cytoplasmic dynein 1 heavy chain 1|dynein heavy chain, cytosolic|dynein, cytoplasmic, heavy polypeptide 1|dynein, cytoplasmic-like
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com