Product Browser

Last updated: 2016/12/11
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNCH1 polyclonal antibody (A01)

  • Catalog # : H00001778-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DNCH1.
  • Immunogen:
  • DNCH1 (AAH21297, 733 a.a. ~ 832 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TSQGATLDACSFGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKASVVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYERGVAVLCTE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001778-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1778
  • Gene Name:
  • DYNC1H1
  • Gene Alias:
  • DHC1,DHC1a,DKFZp686P2245,DNCH1,DNCL,DNECL,DYHC,Dnchc1,HL-3,KIAA0325,p22
  • Gene Description:
  • dynein, cytoplasmic 1, heavy chain 1
  • Gene Summary:
  • Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family. [provided by RefSeq
  • Other Designations:
  • cytoplasmic dynein 1 heavy chain 1,dynein heavy chain, cytosolic,dynein, cytoplasmic, heavy polypeptide 1,dynein, cytoplasmic-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook