DMPK monoclonal antibody (M01), clone 2F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DMPK expression in transfected 293T cell line by DMPK monoclonal antibody (M01), clone 2F7.
Lane 1: DMPK transfected lysate(69.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DMPK is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of DMPK over-expressed 293 cell line, cotransfected with DMPK Validated Chimera RNAi ( Cat # H00001760-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DMPK monoclonal antibody (M01) clone 2F7 (Cat # H00001760-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (39.09 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DMPK.
Immunogen
DMPK (AAH62553, 303 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DMPK expression in transfected 293T cell line by DMPK monoclonal antibody (M01), clone 2F7.
Lane 1: DMPK transfected lysate(69.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DMPK is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of DMPK over-expressed 293 cell line, cotransfected with DMPK Validated Chimera RNAi ( Cat # H00001760-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DMPK monoclonal antibody (M01) clone 2F7 (Cat # H00001760-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — DMPK
Entrez GeneID
1760GeneBank Accession#
BC062553Protein Accession#
AAH62553Gene Name
DMPK
Gene Alias
DM, DM1, DM1PK, DMK, MDPK, MT-PK
Gene Description
dystrophia myotonica-protein kinase
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-37 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
DM protein kinase|dystrophia myotonica 1|myotonic dystrophy associated protein kinase|myotonic dystrophy protein kinase|myotonin protein kinase A|thymopoietin homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com