DLX6 monoclonal antibody (M06), clone 2D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DLX6 expression in transfected 293T cell line by DLX6 monoclonal antibody (M06), clone 2D7.
Lane 1: DLX6 transfected lysate(19.708 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DLX6 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DLX6.
Immunogen
DLX6 (XP_376652, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DLX6 expression in transfected 293T cell line by DLX6 monoclonal antibody (M06), clone 2D7.
Lane 1: DLX6 transfected lysate(19.708 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DLX6 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — DLX6
Entrez GeneID
1750GeneBank Accession#
XM_376652Protein Accession#
XP_376652Gene Name
DLX6
Gene Alias
MGC125282, MGC125283, MGC125284, MGC125285
Gene Description
distal-less homeobox 6
Omim ID
600030Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq
Other Designations
distal-less homeo box 6
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com