DLX6 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
DLX6 MaxPab rabbit polyclonal antibody. Western Blot analysis of DLX6 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of DLX6 expression in transfected 293T cell line (H00001750-T02) by DLX6 MaxPab polyclonal antibody.
Lane 1: DLX6 transfected lysate(19.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human DLX6 protein.
Immunogen
DLX6 (AAH69363.1, 1 a.a. ~ 175 a.a) full-length human protein.
Sequence
MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DLX6 MaxPab rabbit polyclonal antibody. Western Blot analysis of DLX6 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of DLX6 expression in transfected 293T cell line (H00001750-T02) by DLX6 MaxPab polyclonal antibody.
Lane 1: DLX6 transfected lysate(19.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — DLX6
Entrez GeneID
1750GeneBank Accession#
BC069363.1Protein Accession#
AAH69363.1Gene Name
DLX6
Gene Alias
MGC125282, MGC125283, MGC125284, MGC125285
Gene Description
distal-less homeobox 6
Omim ID
600030Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq
Other Designations
distal-less homeo box 6
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com