DLX5 monoclonal antibody (M12), clone 3B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant DLX5.
Immunogen
DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.79 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DLX5 monoclonal antibody (M12), clone 3B11. Western Blot analysis of DLX5 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
DLX5 monoclonal antibody (M12), clone 3B11. Western Blot analysis of DLX5 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
DLX5 monoclonal antibody (M12), clone 3B11. Western Blot analysis of DLX5 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
DLX5 monoclonal antibody (M12), clone 3B11 Western Blot analysis of DLX5 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody (M12), clone 3B11.
Lane 1: DLX5 transfected lysate(31.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DLX5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DLX5
Entrez GeneID
1749GeneBank Accession#
NM_005221Protein Accession#
NP_005212Gene Name
DLX5
Gene Alias
-
Gene Description
distal-less homeobox 5
Omim ID
600028Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq
Other Designations
distal-less homeo box 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com