DLX3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (57.68 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant DLX3.
Immunogen
DLX3 (AAH12361, 1 a.a. ~ 287 a.a) full-length recombinant protein with GST tag.
Sequence
MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.68 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — DLX3
Entrez GeneID
1747GeneBank Accession#
BC012361Protein Accession#
AAH12361Gene Name
DLX3
Gene Alias
AI4, TDO
Gene Description
distal-less homeobox 3
Gene Ontology
HyperlinkGene Summary
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. [provided by RefSeq
Other Designations
distal-less homeo box 3
-
Interactome
-
Disease
-
Publication Reference
-
Stem cell function and stress response are controlled by protein synthesis.
Blanco S, Bandiera R, Popis M, Hussain S, Lombard P, Aleksic J, Sajini A, Tanna H, Cortés-Garrido R, Gkatza N, Dietmann S, Frye M.
Nature 2016 Jun; 534(7607):335.
Application：IF, Mouse, Mouse squamous tumours.
-
The RNA-Methyltransferase Misu (NSun2) Poises Epidermal Stem Cells to Differentiate.
Blanco S, Kurowski A, Nichols J, Watt FM, Benitah SA, Frye M.
PLoS Genetics 2011 Dec; 7(12):e1002403.
Application：IF, IHC, Mouse, Epidermal stem cells, Hair follicles.
-
The Vitamin D Receptor Is a Wnt Effector that Controls Hair Follicle Differentiation and Specifies Tumor Type in Adult Epidermis.
Palmer HG, Anjos-Afonso F, Carmeliet G, Takeda H, Watt FM.
PLoS ONE 2008 Jan; 3(1):e1483.
Application：IF, Mouse, Hair follicles.
-
Stem cell function and stress response are controlled by protein synthesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com