DLX1 monoclonal antibody (M01), clone 2H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DLX1.
Immunogen
DLX1 (NP_835221, 152 a.a. ~ 255 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.55 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of DLX1 transfected lysate using anti-DLX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with DLX1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DLX1 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DLX1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — DLX1
Entrez GeneID
1745GeneBank Accession#
NM_178120Protein Accession#
NP_835221Gene Name
DLX1
Gene Alias
-
Gene Description
distal-less homeobox 1
Omim ID
600029Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000082494|OTTHUMP00000082497|distal-less homeo box 1
-
Interactome
-
Disease
-
Publication Reference
-
Kruppel-like factor 4-dependent Staufen1-mediated mRNA decay regulates cortical neurogenesis.
Moon BS, Bai J, Cai M, Liu C, Shi J, Lu W.
Nature Communications 2018 Jan; 9(1):401.
Application:WB, Mouse, Neural progenitor cells.
-
Up-regulation of homeodomain genes, DLX1 and DLX2, by FLT3 signaling.
Starkova J, Gadgil S, Qiu YH, Zhang N, Hermanova I, Kornblau SM, Drabkin HA.
Haematologica 2011 Jun; 96(6):820.
Application:WB-Ce, Human, MV4;11, RS4;11 cells.
-
Kruppel-like factor 4-dependent Staufen1-mediated mRNA decay regulates cortical neurogenesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com